Protein Info for BPHYT_RS13260 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 transmembrane" amino acids 152 to 172 (21 residues), see Phobius details amino acids 263 to 279 (17 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details PF18071: HMW1C_N" amino acids 5 to 145 (141 residues), 67.7 bits, see alignment E=1.1e-22 PF18254: HMw1_D2" amino acids 151 to 237 (87 residues), 69.9 bits, see alignment E=2.6e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2679)

Predicted SEED Role

"putative accessory processing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXZ5 at UniProt or InterPro

Protein Sequence (624 amino acids)

>BPHYT_RS13260 glycosyl transferase family 1 (Burkholderia phytofirmans PsJN)
MEESTFSLDHFEQLVYTRQHVKAAIQFIAALALLQQKRGELDGSFRASGMADLPPAEQRK
RFCTRLASAASTLFADPAFQLPPECFRLLLTLHEWVGVVFACTPFGNADHVSRHLNPRGP
DNTQFLLGDSFIEKLCVLYSTESELELNFAALWAYDKSLAACLALVLLAPVFKGSASAHL
KREALMEWLPGKLQQIDDLDDLPTALLHNAYMFCSYADTPRRHEIKRDINALVRRKLDQL
GLTDIPAPQLARAKSRKQRGKKPLMLVVLEWFSGAHSIYRTHSLTLEAAREHFEVVAFGF
GYAVDDVGRAAFDRFIELEEPEYIGECLKTIRDFAEAEQPDVLYMPSVGMFALTVFMSNL
RVAPLQIAGLGHPATTHSDKIDYVSVEEDYVGNPACFSERLMKLPKDGQPYRPSVALPDI
VAEIPPSRETLEIVITASAMKLNPGFLETCREIGERAATPVQFHFMSGVPFGLPLERMRD
VIRQTLPRAFVHSFHEYAGYLSRVNRSDLFLSPFPFGNTNGIVDALTLGLPGICKRGPEV
FERIDGALFERVGMPSWTTAESGEDYIAAAVRMIDAHGERTALRQRLIDTRAVERCFEGR
PQAFAECVLGRMRAKQRKRDEAMA