Protein Info for BPHYT_RS13240 in Burkholderia phytofirmans PsJN

Annotation: multidrug DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details PF00892: EamA" amino acids 9 to 140 (132 residues), 63.4 bits, see alignment E=1.3e-21 amino acids 163 to 291 (129 residues), 65.2 bits, see alignment E=3.5e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2674)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXZ0 at UniProt or InterPro

Protein Sequence (308 amino acids)

>BPHYT_RS13240 multidrug DMT transporter permease (Burkholderia phytofirmans PsJN)
MNAKNLFQLLILAALWGASFLFIRVGVTDFGVAPLMALRVGIGAAFLAIVLIARRPLRQS
ATILRTRAFPLLVVGILNSAAPFCLFAYAELTLSAGVTSVINASTPLWGALVGFLWLRDR
LSALRTLGLVIGFLGVLMLVWDQIAAPNGTPATPLTTALAAGAALGATLLYGIAANYTKR
HLTGVDALTVATGTMTGATIVLLPLAVIYWPAAPISLHAWGAVIALGVACTGVAYMLFFH
LIAVAGPARAITVTFVIPIFGILWGALFLGEGVSPGMLEGCGVILVGTALATGVIKRLPW
LGTRRADT