Protein Info for BPHYT_RS13185 in Burkholderia phytofirmans PsJN

Annotation: 2,4-dienoyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 682 PF00724: Oxidored_FMN" amino acids 10 to 330 (321 residues), 262.3 bits, see alignment E=3.8e-81 PF01207: Dus" amino acids 139 to 334 (196 residues), 26.7 bits, see alignment E=1.5e-09 PF03486: HI0933_like" amino acids 379 to 417 (39 residues), 27.4 bits, see alignment 7.1e-10 PF00070: Pyr_redox" amino acids 379 to 422 (44 residues), 22.5 bits, see alignment 6.8e-08 PF07992: Pyr_redox_2" amino acids 379 to 648 (270 residues), 79.8 bits, see alignment E=1.3e-25 PF12831: FAD_oxidored" amino acids 380 to 428 (49 residues), 31.8 bits, see alignment 5e-11 PF00890: FAD_binding_2" amino acids 380 to 416 (37 residues), 20.5 bits, see alignment 1.2e-07 PF01134: GIDA" amino acids 380 to 440 (61 residues), 21.6 bits, see alignment 5.3e-08 PF13450: NAD_binding_8" amino acids 382 to 419 (38 residues), 35.2 bits, see alignment 6.2e-12

Best Hits

KEGG orthology group: K00219, 2,4-dienoyl-CoA reductase (NADPH2) [EC: 1.3.1.34] (inferred from 100% identity to bpy:Bphyt_2663)

Predicted SEED Role

"2,4-dienoyl-CoA reductase [NADPH] (EC 1.3.1.34)" (EC 1.3.1.34)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXX9 at UniProt or InterPro

Protein Sequence (682 amino acids)

>BPHYT_RS13185 2,4-dienoyl-CoA reductase (Burkholderia phytofirmans PsJN)
MSYQHLLAELDLGFTRLRNRVVMGSMHTGMEDRFWNYPKLAAYFRERAKGGVGLIVTGGI
SPNREGWLLPFGGTLNSVFDLRNHRKLTEAVHAEGGKIALQILHAGRYGYQPFVVSASAI
KSPISKFKPRALSIAGIAKTVRDYARCARLAQRAGYDGIEIMGSEGYLLNQFLCPRTNHR
ADAYGGSIENRMRLAREIVERVRAVCGERFIVVYRISLIDLVEGGNTWDETVQVAQALEA
AGVTMFNTGIGWHEARVPTIVTSVPRAAFAELSARLKAAVKVPVIVSNRINTPEVAEALL
AQGAGDLVSMARPLLADPEFVVKTAEGRAHEINTCIACNQACLDHTFKNQRATCLVNPRA
GRETELIYRPVAGAQAARSIAVVGAGPAGLSAATVAAARGHRVTLFDASATIGGQFNLAM
RVPGKEEFSETIRYFQSQLQRHRVDVRLDTRVDPALLAAGAYDDVIVATGIVPRRPAIAG
IDGPNVLSYVDVLRGAPVGQRVAVIGAGGIGFDVSEFLLHRAGEPLPVPRDAWLDEWGVD
LAVRERGGLKPPAPAQPPRQIWLLQRKAGKLGMGLGKTSGWVHRATLARNGVKMLDGVSY
REISARGLKIARDGVEEWLEVDTIVVCAGQESLRDLLPQTAADAKTDHAAGPRYHVIGGA
KVATELDAKRAIREGAEVAAAL