Protein Info for BPHYT_RS12995 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 63 to 64 (2 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details amino acids 391 to 415 (25 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 38 to 253 (216 residues), 113 bits, see alignment E=1.7e-36 amino acids 245 to 451 (207 residues), 63.8 bits, see alignment E=1.5e-21 PF07690: MFS_1" amino acids 40 to 385 (346 residues), 121.5 bits, see alignment E=3.9e-39

Best Hits

Swiss-Prot: 49% identical to PROP_SALTY: Proline/betaine transporter (proP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 100% identity to bpy:Bphyt_2625)

MetaCyc: 51% identical to osmolyte:H+ symporter ProP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-29; TRANS-RXN-29A

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5R8 at UniProt or InterPro

Protein Sequence (489 amino acids)

>BPHYT_RS12995 MFS transporter (Burkholderia phytofirmans PsJN)
MTASSNGFWRHHKEEQRLSLDDITVVDKSLLKRAVGAMALGNAMEWFDFGVYSYIAVTLG
KVFFPSASPAAQLIATFGTFAAAFLVRPVGGMVFGPLGDRIGRQRVLAMTMIMMALGTFA
IGLIPSYTTIGIFAPMLLLVARLVQGFSTGGEYGGAATFIAEFSTDKRRGFMGSFLEFGT
LIGYVLGAGTVAVLTATLSNDALLSWGWRVPFLIAGPLGLVGLYIRMKLEETPAFKKQAE
QREAEDKAVPKQSFGQLLAQQWKPLLLCVGLVLIFNVTDYMALSYLPSYLSATLHFNETH
GLFLVLLVMVLMMPMTLAAGRLSDTIGRKPVMLFGCVGLFALSIPALLLIRMGTVLPVFG
GLMILGVLLSCFTGVMPSALPALFPTKIRYGALAIGFNISVSLFGGTTPLVTAWLVDRTG
NLMMPAYYLMGASLIGIVSVVALRETARKPLLGSGPCVATRAEAHAVLRGEREAEEMDER
YAATATARA