Protein Info for BPHYT_RS12830 in Burkholderia phytofirmans PsJN

Annotation: dihydrolipoamide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 5 to 74 (70 residues), 65.6 bits, E=1.3e-21
• PF13533: Biotin_lipoyl_2
  • amino acids 46 to 77 (32 residues), 25.4 bits, see alignment (E = 4.5e-09)
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 135 to 586 (452 residues), 482.1 bits, E=8.3e-149
• PF07992: Pyr_redox_2
  • amino acids 136 to 456 (321 residues), 213.2 bits, E=2.5e-66
• PF12831: FAD_oxidored
  • amino acids 136 to 173 (38 residues), 32 bits, 3.9e-11
• PF01134: GIDA
  • amino acids 136 to 200 (65 residues), 25.6 bits, E=2.8e-09
• PF00070: Pyr_redox
  • amino acids 304 to 379 (76 residues), 54.7 bits, E=5.5e-18
• PF02852: Pyr_redox_dim
  • amino acids 475 to 583 (109 residues), 116.1 bits, E=4.1e-37

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to bpy:Bphyt_2589)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

See B2T5N2 at UniProt or InterPro

Protein Sequence (600 amino acids)

>BPHYT_RS12830 dihydrolipoamide dehydrogenase (Burkholderia phytofirmans PsJN)
MSLVEVKVPDIGDFKDVDVIEVNIKAGDVIENEQALMTLESDKASIEVPSDTAGTVKEVR
VKAGDKVSQGTVIALVETSADAAPAKDAPKAPAKEPEKAPAQAEAKPQAAQAAPAKAATP
APQAGSFSGNADIECDMLVLGSGPGGYSAAFRSADLGMKTVLVERYATLGGVCLNVGCIP
SKALLHTALVIDEAEALRSHGITFGKPQIDLDKLRDFKSGVVKKLTGGLAGMAKMRKVEV
VTGTGSFVDPHHMEVQVEGGKKVVKFKQAIIAAGSEAVKLPFIPEDPRVVDSTGALELRQ
IPQRMLVIGGGIIGLEMATVYATLGAQIDVVEMLDGLMAGADRDLVKVWEKYNSKRFANV
MLKTKTTAAEAKDDGIYVSFEGEKAPAEAQRYDLVLVAVGRSPNGKKIGADKAGVAVTER
GFIDVDKQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEVAHGEKAYFDALQIPSVAY
TDPEVAWAGKTEDQLKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLLFDEETHRVIGGG
IVGLNAGDLISEVCLAVEMGADATDIGKTIHPHPTLGESIGMAAELYEGVCTDLPPQKKK