Protein Info for BPHYT_RS12740 in Burkholderia phytofirmans PsJN

Annotation: lysine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 TIGR00499: lysine--tRNA ligase" amino acids 26 to 516 (491 residues), 661.4 bits, see alignment E=4e-203 PF01336: tRNA_anti-codon" amino acids 78 to 155 (78 residues), 56.8 bits, see alignment E=1.8e-19 PF00152: tRNA-synt_2" amino acids 171 to 514 (344 residues), 321.9 bits, see alignment E=4.5e-100

Best Hits

Swiss-Prot: 100% identical to SYK_PARPJ: Lysine--tRNA ligase (lysS) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K04567, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 100% identity to bpy:Bphyt_2571)

Predicted SEED Role

"Lysyl-tRNA synthetase (class II) (EC 6.1.1.6)" (EC 6.1.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXV7 at UniProt or InterPro

Protein Sequence (518 amino acids)

>BPHYT_RS12740 lysine--tRNA ligase (Burkholderia phytofirmans PsJN)
MTEPTQPNAAQPDAARPNVAPEMDDNKIMTERREKLRELREQGVAYPNDFRPTHHAEDLQ
SQYEQSDKEALEANPLEVAIAGRMMLKRVMGKASFATVRDGSGQIQFFITPTDVGQETYD
AFKKWDMGDIVAARGVLFRTNKGELSVRCTELRLLSKSLRPLPDKFHGLADQEMKYRQRY
VDLIVTPETRKTFVARTKAISSIRKFMAEADFMEVETPMLHPIPGGAAAKPFTTHHNALD
MQMFLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSVRHNPEFTMIEFYAAYTDYKWLM
DFTEQLIRQAAIDALGTATITYQGRELDLAKPFHRLTITQAIQKYAPQYTNEQLADSAFL
RTELKKFGVDASQPQFLNAGVGSLQLALFEETAESQLWEPTYIIDYPIEVSPLARASDKV
AGITERFELFITGREIANGFSELNDPEDQAARFKKQVDQKEAGDEEAMFYDADYIRALEY
GMPPAGGCGIGIDRLVMMLTDSPSIRDVILFPHLRRED