Protein Info for BPHYT_RS12735 in Burkholderia phytofirmans PsJN

Annotation: peptide chain release factor 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR00020: peptide chain release factor 2" amino acids 1 to 246 (246 residues), 429.3 bits, see alignment E=5.6e-133 PF03462: PCRF" amino acids 4 to 103 (100 residues), 140.6 bits, see alignment E=5.5e-45 PF00472: RF-1" amino acids 112 to 220 (109 residues), 149.5 bits, see alignment E=3.9e-48

Best Hits

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 99% identity to bxe:Bxe_A1562)

Predicted SEED Role

"Peptide chain release factor 2; programmed frameshift-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>BPHYT_RS12735 peptide chain release factor 2 (Burkholderia phytofirmans PsJN)
MFANPADPNNAFLDIQAGAGGTEACDWASMLLRQYLRYCERKGFKTEVLEQTDGDVAGIK
NATIKIEGEYAYGFLRTETGVHRLVRKSPFDSSGGRHTSFSSVFVYPEIDDSIEVDINPA
DLRIDTYRASGAGGQHINKTDSAVRITHIPSGIVVQCQNDRSQHRNRAEAMAMLKSRLYE
AEIRKRQEEQDKLEAGKTDVGWGHQIRSYVLDNSRIKDLRTNVEISNTKSVLDGDLDPFI
SASLKQGV