Protein Info for BPHYT_RS12630 in Burkholderia phytofirmans PsJN

Annotation: peptidase M50

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 96 to 123 (28 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 175 to 198 (24 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details PF02163: Peptidase_M50" amino acids 138 to 189 (52 residues), 31.9 bits, see alignment E=4.4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bxe:Bxe_A1582)

Predicted SEED Role

"FIG004556: membrane metalloprotease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXU0 at UniProt or InterPro

Protein Sequence (220 amino acids)

>BPHYT_RS12630 peptidase M50 (Burkholderia phytofirmans PsJN)
MDSSLIQTIAVYALPVIFAITLHEAAHGYVARWLGDNTAYVLGRVSVNPMRHIDPLGTIA
IPLLLYFATSGAFMFGYAKPVPVAFGNLRNPRWGSLWVAAAGPACNFVQAVIWGLFGVAL
AVLNVDEPFFTRMAGAGVGVNLVLGVLNLFPLPPLDGGRVLMALLPPRQSITLSRLEPYG
FFIVMALVMTGTLTRYWLNPLVTIGYSAITAILTPLVSLF