Protein Info for BPHYT_RS12575 in Burkholderia phytofirmans PsJN

Annotation: histidine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 TIGR00442: histidine--tRNA ligase" amino acids 14 to 412 (399 residues), 506.9 bits, see alignment E=2.1e-156 PF13393: tRNA-synt_His" amino acids 16 to 318 (303 residues), 171.5 bits, see alignment E=4e-54 PF00587: tRNA-synt_2b" amino acids 80 to 324 (245 residues), 70.5 bits, see alignment E=3e-23 PF03129: HGTP_anticodon" amino acids 335 to 434 (100 residues), 40.8 bits, see alignment E=3e-14

Best Hits

Swiss-Prot: 100% identical to SYH_PARPJ: Histidine--tRNA ligase (hisS) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 100% identity to bpy:Bphyt_2540)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXS9 at UniProt or InterPro

Protein Sequence (446 amino acids)

>BPHYT_RS12575 histidine--tRNA ligase (Burkholderia phytofirmans PsJN)
MTEQKKKLEKLSGVKGMNDILPQEAGLWEFFETTVKSMLRSYGYQNIRTPIVEHTQLFKR
GIGEVTDIVEKEMYSFTDALNGENLTMRPENTAAVVRAAIEHNMLYDGPKRLWYIGPMFR
HERPQRGRYRQFHQVGVEALGFAGPDADAEIIMMCQRLWDDLGLMGIKLEINSLGLAEER
AAHRVELIAHLEKHMDVLDEEAKRRLYTNPLRVLDTKNPAMQEVAQNAPKLIDFLGEESR
AHFEGLQRILKANNIPFTINPRLVRGLDYYNLTVFEWVTDKLGAQGTVAAGGRYDPLIEQ
LGGKPTAACGWAMGIERILELLKEEQLVPEDEGCDVYVVHQGDAAREQAFIIAERLRDTG
LDVILHCSADGQTASFKSQMKRADASGAAFAVVLGEDEIANGTVGVKPLRDTNANGGKNE
QQNVPAEDLTEFLINAMVATAEDGDD