Protein Info for BPHYT_RS12565 in Burkholderia phytofirmans PsJN

Annotation: pyrrolo-quinoline quinone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 11 to 378 (368 residues), 434.1 bits, see alignment E=1.8e-134 PF13570: PQQ_3" amino acids 47 to 86 (40 residues), 21.5 bits, see alignment 3.7e-08 amino acids 126 to 165 (40 residues), 37.1 bits, see alignment 4.5e-13 amino acids 348 to 380 (33 residues), 19.6 bits, see alignment 1.6e-07 PF13360: PQQ_2" amino acids 76 to 307 (232 residues), 216.9 bits, see alignment E=4.8e-68 amino acids 291 to 378 (88 residues), 27.2 bits, see alignment E=4.4e-10 PF01011: PQQ" amino acids 147 to 180 (34 residues), 24.4 bits, see alignment 2.8e-09

Best Hits

Swiss-Prot: 78% identical to BAMB_BURPS: Outer membrane protein assembly factor BamB (bamB) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2538)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXS7 at UniProt or InterPro

Protein Sequence (381 amino acids)

>BPHYT_RS12565 pyrrolo-quinoline quinone (Burkholderia phytofirmans PsJN)
MNLLKRYAVPVACAMTVLTMAACSSTKDERRVPTPLTEFKPVLDVQQAWKASVGKAGRYL
FSPVAVGNAVYAAGANGSVAKIDAQTGQDVWRVKLHDDLSAGVGSDGTLTAVGGLKGDVY
VLGADGKQLWTAKAPGEIISPPLVGNGLVVVRTVDGQITAFNAQTGEQKWNYRNRAVPLN
LRVSSGMTFAGDAAVLAGFPGGAFAAINVQTGDNYWQTPVSYPKGVTEVERINDVTGPPT
LVGSETCAVTFQGQIGCFDANSGRAVWEKAFSSTSGLAQDDRAVVAADDWSVVSAFDTNS
GALLWKNDKLKNRDLSVPFILGHAAVLGDYQGYVHFLSRDDGTLVARVKTDGSPITAAPV
LAGETLVVLTHDGDLYGYRPR