Protein Info for BPHYT_RS12410 in Burkholderia phytofirmans PsJN

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00656: aspartate kinase, monofunctional class
  • amino acids 1 to 413 (413 residues), 420.1 bits, E=9.6e-130
• PF00696: AA_kinase
  • amino acids 3 to 229 (227 residues), 179.1 bits, E=1.8e-56
• TIGR00657: aspartate kinase
  • amino acids 61 to 412 (352 residues), 377.3 bits, E=1.2e-116
• PF01842: ACT
  • amino acids 276 to 329 (54 residues), 32.3 bits, 1e-11
• PF13840: ACT_7
  • amino acids 348 to 409 (62 residues), 65.7 bits, E=4.1e-22

Best Hits

Swiss-Prot: 65% identical to AK_PSEFS: Aspartate kinase (PFLU_4747) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to bpy:Bphyt_2506)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• ectoine biosynthesis (3/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• norspermidine biosynthesis (3/6 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• superpathway of polyamine biosynthesis III (3/8 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

See B2SXP5 at UniProt or InterPro

Protein Sequence (416 amino acids)

>BPHYT_RS12410 aspartate kinase (Burkholderia phytofirmans PsJN)
MALIVHKYGGTSMGSVERIKNVAKRVAKWHKAGHKMVVVPSAMSGETNRLLGLAKEITGQ
PSPRELDMIAATGEQVSSGLLAIALQEAGVDAVSYAGWQVPVKTDSAFTKARISEIDGER
VLRDLDAGKVVVITGFQGIDPDGHITTLGRGGSDTSAVAVAAALKADECLIYTDVDGVYT
TDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLMPLD
AEMKSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVEGKTAFTFTVGRGDYQRAMDILTTQVKGHVQAEQVLGDPKVSKVSVVGVGM
RSHVGIASTMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA