Protein Info for BPHYT_RS12380 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 151 to 177 (27 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 308 to 334 (27 residues), see Phobius details PF00528: BPD_transp_1" amino acids 131 to 338 (208 residues), 118.3 bits, see alignment E=1.8e-38

Best Hits

Swiss-Prot: 57% identical to YEJB_ECOLI: Inner membrane ABC transporter permease protein YejB (yejB) from Escherichia coli (strain K12)

KEGG orthology group: K13894, microcin C transport system permease protein (inferred from 100% identity to bpy:Bphyt_2500)

MetaCyc: 57% identical to putative oligopeptide ABC transporter membrane subunit YejB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXP0 at UniProt or InterPro

Protein Sequence (345 amino acids)

>BPHYT_RS12380 ABC transporter permease (Burkholderia phytofirmans PsJN)
MWSYILKRLLLMIPTLLGVLTLTFVVIQFVPGGPVEQMQHELRKGAENGAPFGLRAHNGV
DAQQIAQLKALYGFDKPPLERYVLMLKRFSTFDLGQSYFRHQSVWSLIVSKLPVSISIGL
WTFFLTYLISVPLGIAKAVRNGSRFDVATSLVVLVGYAIPGFVLGVLLLVLFGGGTFLQL
FPLRNLTSDNWAQLSVAGRILDYLWHIALPITASVVGSFAVVTMLTKNAFLDEIRKQYVL
TARAKGLSEKRVLWKHVFRNALLPLIVGFPAAFIGAFFTGSLLIETLFSLDGLGLLSYES
VVRRDYPVVLGTLYLFTLIGLATKLISDLCYVWVDPRIQFEQLER