Protein Info for BPHYT_RS12370 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 PF00005: ABC_tran" amino acids 34 to 190 (157 residues), 105.7 bits, see alignment E=1.1e-33 amino acids 314 to 466 (153 residues), 121.3 bits, see alignment E=1.7e-38 PF13304: AAA_21" amino acids 147 to 229 (83 residues), 29.2 bits, see alignment E=3.1e-10 PF08352: oligo_HPY" amino acids 245 to 271 (27 residues), 25.6 bits, see alignment (E = 4.5e-09) amino acids 517 to 541 (25 residues), 25.8 bits, see alignment (E = 3.9e-09)

Best Hits

KEGG orthology group: K13896, microcin C transport system ATP-binding protein (inferred from 100% identity to bpy:Bphyt_2498)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXN8 at UniProt or InterPro

Protein Sequence (544 amino acids)

>BPHYT_RS12370 ABC transporter (Burkholderia phytofirmans PsJN)
MSANLQNTASRTTPPPLLELDHLHVRFGDTVAVSDVTLAIQRGERVALVGESGSGKSVTA
LSILRLLSDAQVSGSIRFDGEDLLGKTEREMRGMRGSDIAMIFQEPMTALNPLYTVGDQI
AETIVVHDGVSANEARKRAVALLGRTGIAEPGKRVNSYPHQLSGGQRQRAMIAMALACRP
RLLLADEPTTALDVTIRAQIVDLLLELQRDEAEKRGMAVLLITHDLNLVRHFAQRIAVME
KGVLVESGPVEQVFESPQHPYTQRLLASRPQRTVVPVLPISPVLLEAREISVDFKTKLPG
FSGWFRSGRFRAVADANVSVRQGETLGIVGESGSGKSTLAMALLGLQRTVHGEIEFQGRA
LGSYRGAEQTALRSNMQVVFQDPFSSLSPRQTIERIVGEGLALHRPAMTPQARRDKVISV
LREVGLDRTVLQRYPHEFSGGQRQRIAIARALVLEPRILILDEPTSALDVSIQQQVLKLL
AGLQQKYNLGFVFISHDLAVIGAMAHRVAVMQNGSIVESGEVEEIFSTPAHPYTRKLLKA
ALDH