Protein Info for BPHYT_RS12270 in Burkholderia phytofirmans PsJN

Annotation: O-sialoglycoprotein endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03725: tRNA threonylcarbamoyl adenosine modification protein YeaZ
  • amino acids 6 to 235 (230 residues), 188.7 bits, E=6.6e-60
• PF00814: TsaD
  • amino acids 53 to 266 (214 residues), 108.8 bits, E=2.1e-35

Best Hits

KEGG orthology group: K14742, hypothetical protease [EC: 3.4.-.-] (inferred from 100% identity to bpy:Bphyt_2483)

Predicted SEED Role

"TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

See B2SXM3 at UniProt or InterPro

Protein Sequence (276 amino acids)

>BPHYT_RS12270 O-sialoglycoprotein endopeptidase (Burkholderia phytofirmans PsJN)
MTQTVLLALDTSTEFCSVALLSAAGNASGATPEEARAEPRLWVRHEQTGAVSSTRLLPAI
RELFDEAGLSLADCDAIAFGSGPGSFTGLRTATGVAQGLAFGLNLPVVPVSTLLACAESA
RLRDPSATRVLAALDARMDEIYWADYAWDDAQGEWRTLQAASLDAPDRLVLPDVPFTLAG
NAAAAFGARLPALAAARSVDSEALPHAVPLAHAALRALRAGRTVPADQAAPEYVRDKVAQ
TTAERVADKAEKAEKAARAEQAARLAHDAAQGEGRQ