Protein Info for BPHYT_RS12215 in Burkholderia phytofirmans PsJN

Annotation: glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00255: GSHPx
  • amino acids 4 to 110 (107 residues), 145.1 bits, E=5.4e-47
• PF00578: AhpC-TSA
  • amino acids 6 to 94 (89 residues), 28.9 bits, E=9.8e-11

Best Hits

Swiss-Prot: 64% identical to GPX1_SYNY3: Hydroperoxy fatty acid reductase gpx1 (gpx1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 100% identity to bpy:Bphyt_2472)

MetaCyc: 64% identical to hydroperoxy fatty acid reductase 1 (Synechocystis sp. PCC 6803)
RXN-13944 [EC: 1.11.1.22]; 1.11.1.- [EC: 1.11.1.22]

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• glutathione-peroxide redox reactions (1/3 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.22 or 1.11.1.9

Sequence Analysis Tools

See B2T5L1 at UniProt or InterPro

Protein Sequence (159 amino acids)

>BPHYT_RS12215 glutathione peroxidase (Burkholderia phytofirmans PsJN)
MTSIYSFSAHTLAGEEVSLGQYEGKVLLIVNTASECGFTPQYAGLQKLYDTYAARGLTVL
GFPCNQFGKQEPGDAAQIGSFCEKNYGVTFPMFDKVDVNGANAHPLFRYLTGEAPGLLGL
EAIKWNFTKFLIGRDGNVVKRYAPLTKPEAITEDIEKLL