Protein Info for BPHYT_RS12210 in Burkholderia phytofirmans PsJN

Annotation: cardiolipin synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 10 to 483 (474 residues), 365 bits, see alignment E=3.5e-113 PF13396: PLDc_N" amino acids 17 to 59 (43 residues), 24.3 bits, see alignment 3.7e-09 PF13091: PLDc_2" amino acids 135 to 240 (106 residues), 27.8 bits, see alignment E=3e-10 amino acids 324 to 446 (123 residues), 101.3 bits, see alignment E=5.8e-33 PF00614: PLDc" amino acids 397 to 423 (27 residues), 27.1 bits, see alignment (E = 4.9e-10)

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 100% identity to bpy:Bphyt_2471)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5L0 at UniProt or InterPro

Protein Sequence (483 amino acids)

>BPHYT_RS12210 cardiolipin synthetase (Burkholderia phytofirmans PsJN)
MQFDLLHIGTLVALCHILGVAAACHAILNTRTSQGAIAWAVSLVAMPYLTLVPYLFLGRS
KFAGYADARRVENELLRTRAHPPEWDTRASSAGLPTLELGGRLVHSLTHLGGMPFLPGNS
VRTLVNGAATFEAIFDAIENARRYVIVQFFIVRDDALGEMLKDALIAKAQQGVRVYFLYD
SIGSFDLPHRYVAALRAGGVETHPFATNRRFVNRLQLNFRNHRKIVSVDGERAFVGGHNV
GVEYLGGKPPLSPWRDTHIEVRGPAVASIQFVFTEDWHWATQQLPEFDMPPAPATGSAAG
HNMHCLVVPSGPADKQETCSLFFVEAINAARERVWITSPYLIPDEAVFSALRLAALRGVD
VRILIPSRRDHLVVFAASKLYAYDSLRAGIRIFRYQPGFLHQKVVLIDSAAAAIGSANLD
NRSFRLNFEIMVLTVDRGFAKEVETMLLADFAESREIDRNEYRKATALKRVLMHVARLFS
PIL