Protein Info for BPHYT_RS12120 in Burkholderia phytofirmans PsJN

Annotation: UDP diphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00055: di-trans,poly-cis-decaprenylcistransferase
  • amino acids 16 to 242 (227 residues), 291.7 bits, E=1.7e-91
• PF01255: Prenyltransf
  • amino acids 23 to 242 (220 residues), 287.6 bits, E=3.2e-90

Best Hits

Swiss-Prot: 63% identical to ISPT_NITEU: Isoprenyl transferase (uppS) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K00806, undecaprenyl diphosphate synthase [EC: 2.5.1.31] (inferred from 100% identity to bpy:Bphyt_2451)

Predicted SEED Role

"Undecaprenyl diphosphate synthase (EC 2.5.1.31)" (EC 2.5.1.31)

MetaCyc Pathways

• polyisoprenoid biosynthesis (E. coli) (5/5 steps found)
• di-trans,poly-cis-undecaprenyl phosphate biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.31

Sequence Analysis Tools

See B2T5J0 at UniProt or InterPro

Protein Sequence (260 amino acids)

>BPHYT_RS12120 UDP diphosphate synthase (Burkholderia phytofirmans PsJN)
MTYTSSTVRVPDVAAVPRHIAIIMDGNGRWATQRRLPRVAGHTRGVDAVRATVEACARQG
VEYLTLFAFSSENWRRPNEEVSFLMRLFVTALEREIGKLHANGIRLRVVGDLARFDTRIR
DLIKRAETKTARNTRLTLTIAANYGGRWDIMQATRKLAEQSALAGKAVEVTEDSFAEHLS
MAYAPEPDLFIRTGGERRVSNFLLWQLAYTEFYFTDTFWPDFDADALGHAIASYAERERR
FGRTSAQLEPQSQNVDSLPC