Protein Info for BPHYT_RS12105 in Burkholderia phytofirmans PsJN

Annotation: zinc metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 24 (5 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details amino acids 434 to 455 (22 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 1 to 459 (459 residues), 338.2 bits, see alignment E=3.4e-105 PF02163: Peptidase_M50" amino acids 9 to 446 (438 residues), 241.1 bits, see alignment E=1.8e-75 PF00595: PDZ" amino acids 224 to 282 (59 residues), 27.4 bits, see alignment E=7.2e-10 PF13180: PDZ_2" amino acids 224 to 287 (64 residues), 34.3 bits, see alignment E=4.9e-12 PF17820: PDZ_6" amino acids 232 to 284 (53 residues), 52.5 bits, see alignment 7.1e-18

Best Hits

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 100% identity to bpy:Bphyt_2448)

Predicted SEED Role

"Membrane-associated zinc metalloprotease" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5I7 at UniProt or InterPro

Protein Sequence (461 amino acids)

>BPHYT_RS12105 zinc metalloprotease (Burkholderia phytofirmans PsJN)
MNLLIELLAFAVAIGVLVVVHEYGHYSVARLCGVKVLRFSIGFGKPLFQWVSPKTGTEWT
IAALPLGGYVKMLDERETSAEPIPAEALPHAFNRQSVWRRFAIVAAGPVANFLLAIVLFA
LVFATGVTEPAAVVAAPAPNTPAAVAGFDGGETIVAVRAENAGESEPVRSWSDLRWKLLG
AAFDHKRVVLSAKDAHGTSDFQLDLRGLTEKDVDDDFMSHLGFEPGGGKLTVAGVQPGSA
AQKAGLAAGDRLRAVDGIPTDNATAFIAYVKSHAGKAVTLQVERGGKAAGKLEDVNIVPQ
AQRDETTGQQIGRIGAELATQVPSIDVRYGPIESLQLGARRTWDLAVYSVRMFGRMIVGE
ASLKNLSGPVTIADYAGKSARLGPSAFLSFLALVSISLGVLNLLPIPVLDGGHLLYYLVE
AVTGKVVSDRWQLVFQRAGLACIVALSAIALFNDLARLIHF