Protein Info for BPHYT_RS12090 in Burkholderia phytofirmans PsJN

Annotation: UDP-3-O-acylglucosamine N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD
  • amino acids 7 to 342 (336 residues), 372.6 bits, E=7e-116
• PF04613: LpxD
  • amino acids 23 to 91 (69 residues), 79 bits, E=1.9e-26
• PF00132: Hexapep
  • amino acids 132 to 163 (32 residues), 28.8 bits, see alignment (E = 7.1e-11)
  • amino acids 150 to 184 (35 residues), 30.3 bits, 2.4e-11
  • amino acids 235 to 270 (36 residues), 28.5 bits, 9.1e-11

Best Hits

Swiss-Prot: 100% identical to LPXD_PARPJ: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to bpy:Bphyt_2445)

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.191)" (EC 2.3.1.191)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (15/25 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Sequence Analysis Tools

See B2T5I4 at UniProt or InterPro

Protein Sequence (370 amino acids)

>BPHYT_RS12090 UDP-3-O-acylglucosamine N-acyltransferase (Burkholderia phytofirmans PsJN)
MAFTLEDIVQRFGGEVVGDGSQRVGSLAPLDQAGPDQLAFLANPKYLAQVETTRAGAVLI
NADDLAKLASRENRNFIVTPNPYAYFARVAQTFIDLAAPKAAPGVHPSATIDPSAQIAAS
AVIGPHVTVEAGAVIGDNVRLDANVVIGRGTRIGAGSHLYPNVAVYHGCKLAERVIVHAG
AVIGSDGFGFAPDFVGEGEARTGSWVKIPQVGGVSIAADVEIGANTTIDRGAMADTIIEE
CVKIDNLVQIGHNCKVGAYTVIAGCAGIAGSTTIGRHCMIGGAVGIAGHVTLADYVIVTA
KSGVSKSLLKPGMYTSAFPAVNHADWNKSAALLRNIDKLRDRIKTLENAAAEKRDGPAPN
AASKATGDKV