Protein Info for BPHYT_RS12070 in Burkholderia phytofirmans PsJN

Annotation: ribonuclease HII

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to RNH2_PARPJ: Ribonuclease HII (rnhB) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03470, ribonuclease HII [EC: 3.1.26.4] (inferred from 100% identity to bpy:Bphyt_2441)

Predicted SEED Role

"Ribonuclease HII (EC 3.1.26.4)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA replication, archaeal or Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5I0 at UniProt or InterPro

Protein Sequence (248 amino acids)

>BPHYT_RS12070 ribonuclease HII (Burkholderia phytofirmans PsJN)
MTLSRAPRRKTVAGASAQQVGLNFETPDDIVCGVDEAGRGPLAGPVVAAAVIFDPSKPMI
RGLDDSKVLTAKKRDELYDKIVDRALAYCIASATVEEIDSLNILHATMLAMKRAVEGLSV
VPTLVKIDGNRCPTLSVRSEAVIGGDALVKSISAASILAKVTRDRMLLELHQTHPVYGFN
AHAGYGTPQHLKALREHGPCEHHRRSFAPVREAHLRLSTGMPLPAGEVIVVSEVMFDDDA
FGERGSAV