Protein Info for BPHYT_RS11955 in Burkholderia phytofirmans PsJN

Annotation: hemolysin D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details PF16576: HlyD_D23" amino acids 78 to 306 (229 residues), 50.7 bits, see alignment E=3.7e-17 PF13533: Biotin_lipoyl_2" amino acids 79 to 125 (47 residues), 25.4 bits, see alignment 2.3e-09 PF00529: CusB_dom_1" amino acids 200 to 363 (164 residues), 39.5 bits, see alignment E=1.1e-13 PF13437: HlyD_3" amino acids 235 to 314 (80 residues), 51.4 bits, see alignment E=3.9e-17

Best Hits

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to bpy:Bphyt_2416)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5F5 at UniProt or InterPro

Protein Sequence (437 amino acids)

>BPHYT_RS11955 hemolysin D (Burkholderia phytofirmans PsJN)
MSETNTTERPEGRAAAAKHEAATANGAVENAPNPRKRKVLLALLGVAVVMSAAAYGAYYM
TYARYHESTDDAYVSGNLVQLTPQVTGTVVAVNADDTQIVRAGDPVVTLDVADAKVALGN
AEANLGQTVRQVSSLYVNNHFYAANVAQKQSDLVRAQADLRRRQGVADMGAVSAEDIAHS
RDAVTAAQAALDAAHQQAEANRALTDLTTIEQHPNVQAAASKVRDAYLGYARNTLPAPVT
GYVAKRAVQVGQRVSPGTPLMAIVPLDGVWVDANYKENQLRNMRIGQPVTLTADVYGGKV
KYHGRVVGFSAGTGSAFASLPAQNATGNWIKIVQRLPARIQLDQKELEAHPLRIGLSMDV
DVDTRDNTGPQLGAATKTSYRTDVFAEYGAQADAEIEKIIARNIVPLHAGSTGNVASSMP
SAKREAGDRSSTRQRAG