Protein Info for BPHYT_RS11950 in Burkholderia phytofirmans PsJN

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 57 to 77 (21 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 340 to 357 (18 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 407 to 422 (16 residues), see Phobius details amino acids 481 to 502 (22 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 19 to 501 (483 residues), 463.6 bits, see alignment E=3.9e-143 PF07690: MFS_1" amino acids 24 to 418 (395 residues), 177.6 bits, see alignment E=3.5e-56 PF06609: TRI12" amino acids 24 to 300 (277 residues), 31.5 bits, see alignment E=7e-12

Best Hits

Swiss-Prot: 48% identical to FARB_NEIGO: Fatty acid resistance protein FarB (farB) from Neisseria gonorrhoeae

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 100% identity to bpy:Bphyt_2415)

MetaCyc: 47% identical to tripartite efflux pump membrane subunit EmrY (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5F4 at UniProt or InterPro

Protein Sequence (517 amino acids)

>BPHYT_RS11950 DSBA oxidoreductase (Burkholderia phytofirmans PsJN)
MNPSTQLAPPPLTGGKLVLATLAVALATFMNVLDSSIANVAIPTISGNLGVSVDEGTWVI
TLFSAANAVAIPLTGWLTQRVGQIRLFVSAILLFVFSSWLCGIAPNLIVLLAARVLQGAV
AGPLIPLSQAILLGSYPKERSSTALSLWAMTATVGPIAGPALGGWITDSYSWSWIFYINI
PVGLFAAAVTWMIYRDRDSSTRKLPIDKVGLLSLIAWVASLQIMLDKGKDLDWFNSPVIC
VLAVVAGISFLFFLIWEFTEKNPIVELRLFAGRNFRGGTIAISVAYAVFFSNLVILPQWI
QGYLGYRSVDAGLVTAPLGIFAVLLAPVMAKIMPKSDARVLATLAFLGFAGVFFMRSHYT
TSVDPYTLVLPTLLQGIPMALFFTPLTAIILSGLSPERIPAAAGLSNFVRVFAGGVGTSL
ISTGWNDRTILHHAQLAEQSSVNNPSYMSAIANLQTILGGNLEQATAFFERSLNAQAAML
GLNDIFWLSSLIFIVIIPLVWLTRPGKVDGGAAAGAH