Protein Info for BPHYT_RS11945 in Burkholderia phytofirmans PsJN

Annotation: multidrug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details PF01062: Bestrophin" amino acids 28 to 315 (288 residues), 102 bits, see alignment E=2.2e-33

Best Hits

KEGG orthology group: K08994, putative membrane protein (inferred from 100% identity to bpy:Bphyt_2414)

Predicted SEED Role

"FIG028593: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5F3 at UniProt or InterPro

Protein Sequence (335 amino acids)

>BPHYT_RS11945 multidrug transporter (Burkholderia phytofirmans PsJN)
MHLGKSYKLSEFLVWTRRQIYALFLWGSVPVVLYKALGLSWLSVPLSVVVLLGTATSFIV
GFKNVQTYNRAMEAQQIWTSILSASRLWGVIARDFPMDAEVSKALVNRHLAWLTALRYEL
RQPRVWESADKPFNAEYQRFYRIPERAVAIQDLLPLYLPPEETKQVLSSANKPTQVLSLQ
GAAICRLLASGKISVSFYMELERTLRDLIDQQASAERLKNFPYPRQYATINTLFVRFFCL
LFPFGLLQEFNKLNDGVTGFMHGNMVWLVVPFSVVVSWMYTTLEQVGDSTENPFEGGAND
VPISMLCRTVERELKEMLGDVEMAPTPDHETTVVL