Protein Info for BPHYT_RS11930 in Burkholderia phytofirmans PsJN

Annotation: 3-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00106: adh_short" amino acids 6 to 197 (192 residues), 180.6 bits, see alignment E=3.7e-57 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 6 to 260 (255 residues), 332.4 bits, see alignment E=7.7e-104 PF08659: KR" amino acids 8 to 173 (166 residues), 36.7 bits, see alignment E=6.3e-13 PF13561: adh_short_C2" amino acids 12 to 257 (246 residues), 177.3 bits, see alignment E=6.1e-56

Best Hits

Swiss-Prot: 39% identical to YXJF_BACSU: Uncharacterized oxidoreductase YxjF (yxjF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 100% identity to bpy:Bphyt_2411)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5E6 at UniProt or InterPro

Protein Sequence (260 amino acids)

>BPHYT_RS11930 3-hydroxybutyrate dehydrogenase (Burkholderia phytofirmans PsJN)
MALNDKVALVTGAASGIGEQCARKLAADGATVVIADLNLVNAQKVAEDIVKTGAKAIAIG
MDVTSEESVNAGVAETVRRLGSLDVLVSNAGIQIVNRIEEYPFADWKKMLAIHLDGAFLT
TKAAIRHMYASKKGGAVIYMGSVHSHEASQLKSAYVTAKHGLLGLARVVAKEGGPHGVRA
NVVCPGFVRTPLVDKQIPEQAKALGISEQQVVSDVMLKDTVDGEFTSVDDVANTVAFLAG
FESSALTGQSIVVSHGWFMQ