Protein Info for BPHYT_RS11830 in Burkholderia phytofirmans PsJN

Annotation: sodium:solute symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 233 to 250 (18 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details amino acids 315 to 341 (27 residues), see Phobius details amino acids 365 to 383 (19 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details amino acids 459 to 477 (19 residues), see Phobius details PF00474: SSF" amino acids 35 to 381 (347 residues), 80.1 bits, see alignment E=7.9e-27

Best Hits

Swiss-Prot: 51% identical to YHJB_BACSU: Uncharacterized symporter YhjB (yhjB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2389)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5C5 at UniProt or InterPro

Protein Sequence (492 amino acids)

>BPHYT_RS11830 sodium:solute symporter (Burkholderia phytofirmans PsJN)
MNVALVIIILFAAFALGIGLFARRGKKLSLEQWAVGGRGFGSLLTFLLMAGEAFSTFTFL
GASGWTYSKGIPAFYILSYGCLAYVIGYWMLPAIWRYSKERNLVSFADYFASRYESRSIG
VLVSIVAVFAMVSLLIIQLRGLGIIVSEMSYGTIPPAVAIWISAILMTVYMTVSGIHGSA
SIAVVKDVLILGLAIFLGLYLPLHYYGGIGAMFTRINEVHPELLRMPEHGFNLSWYNSTI
LLTSLGYYLYPHGFTAVYVARDAKALRRNVVMMPIYQVLIAFLFLVGFAAILTVHGLEGA
QTDLALLRLVKQTFAPWFVGIVGGAGLLTALVPGSLIMLNASTTIARNIYREGFAPRATE
QQVARVARIALPLFTLVVVYFTLVGGATFVTLAIFSSSLLTQLLPMLASSFLKRPFGTRE
AAFGGIVAGAIVLALVSWRGVTLASLFPGAPATLTSINPGLVALFANAVVFIAISAVQRA
VRARMATSIEST