Protein Info for BPHYT_RS11810 in Burkholderia phytofirmans PsJN

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF00126: HTH_1" amino acids 13 to 71 (59 residues), 68.4 bits, see alignment E=4.3e-23 PF03466: LysR_substrate" amino acids 96 to 292 (197 residues), 120.1 bits, see alignment E=8.6e-39

Best Hits

Swiss-Prot: 42% identical to GCVA_ECOLI: Glycine cleavage system transcriptional activator (gcvA) from Escherichia coli (strain K12)

KEGG orthology group: K03566, LysR family transcriptional regulator, glycine cleavage system transcriptional activator (inferred from 100% identity to bpy:Bphyt_2385)

Predicted SEED Role

"D-serine dehydratase transcriptional activator" in subsystem Glycine and Serine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5C1 at UniProt or InterPro

Protein Sequence (293 amino acids)

>BPHYT_RS11810 LysR family transcriptional regulator (Burkholderia phytofirmans PsJN)
MPSSTKMSRLPPLNALRAFEAAARHLNFRVAAEEIGVTQGAVAQQVRNLEDVLGHQLFDR
VPRGLALTANGSIYFSSVQRALTIIANATEALAHRASSLTVSTTPSFASKWLIPRLATFT
DAHPSIEVRVIADQQLSTFKGDGVDIAIRHGKPPFGKGLAADPLFPVDIYAVCSPSLADA
RRPLKKPSDLKRHVLLHDSHNLWPEFLEALNEGGHVDASKGPRFSQSALAIDAAISGQGI
ALTSEQLVERDLAAGRLCRLFDFALHLSLGYYVVYPEDRRDSETIRAMRDWLI