Protein Info for BPHYT_RS11765 in Burkholderia phytofirmans PsJN

Annotation: polyamine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 192 to 219 (28 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 263 (177 residues), 67.8 bits, see alignment E=5.4e-23

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to bpy:Bphyt_2374)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5B1 at UniProt or InterPro

Protein Sequence (270 amino acids)

>BPHYT_RS11765 polyamine ABC transporter permease (Burkholderia phytofirmans PsJN)
MQEQRNKVLTERVAARWVRLHTALVLFFLIAPILAIIPLSFNSGSYFSYPLQGFSLRWYE
QALTSPDWQRSLLNSIGIGAASTLIATCLGTLAALGISRTQFPLRSLIMPILISPMIVPI
VVVAAGFYLIFAPLGLVNSYPGVVLAHAALGTPFVVITVTASLLSFDQSLLRAASGLGAT
PWITFRRVTLPLITPAVATGSVFAFATSFDEVIVILFIGGPDQRTVPRQMWSGIRDSIDP
SILAVATMLIVFAVLLFASINWLHGSRVRH