Protein Info for BPHYT_RS11760 in Burkholderia phytofirmans PsJN

Annotation: polyamine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 33 to 57 (25 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 217 to 409 (193 residues), 42.9 bits, see alignment E=2.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2373)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T5B0 at UniProt or InterPro

Protein Sequence (417 amino acids)

>BPHYT_RS11760 polyamine ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MPASARATAPGSPTRADGRASFEKARRRASVQALLLALPLIVFLLSTFIAPIALLLARSV
QNHEVPDSMPALTRTLDAWDGRGVPDEHMFALLAAGLREAQQSGQLGTVARRLNFDQAEF
RSLLMRTARQLPANAPPAWKPALIELDPRWDSPEIWRLLKRAASSPTPDYLLAAVDAHVT
PQGAVAFVPDDASIYRQAFARTISISATVTLLCLVLGYPVAWLLANLPAKSSNRLMLFVI
VPFWTSLLVRTTAWYVLLQPGGVINSLLMGLGLTTHPLPLVFNRAGVLIGMTHVLLPYMI
LAIYSVMKSVSPVYVRAAQSLGAHPFTAFVRIYIPQTLPGVGAGCFLVFVLALGYYITPA
LLGGAGDEMISQLIAIQTNTQLNWGLAGALSAYLVIFTAIFYFLFNRIVGIDRLRFG