Protein Info for BPHYT_RS11680 in Burkholderia phytofirmans PsJN

Annotation: protein-L-isoaspartate O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF01135: PCMT" amino acids 12 to 212 (201 residues), 194.1 bits, see alignment E=6.5e-61 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 12 to 213 (202 residues), 203.1 bits, see alignment E=2.5e-64 PF00398: RrnaAD" amino acids 62 to 135 (74 residues), 31.5 bits, see alignment E=2.4e-11 PF13649: Methyltransf_25" amino acids 83 to 152 (70 residues), 31.1 bits, see alignment E=7.6e-11 PF08241: Methyltransf_11" amino acids 84 to 153 (70 residues), 22.1 bits, see alignment E=5.1e-08

Best Hits

Swiss-Prot: 57% identical to PIMT_RHOPA: Protein-L-isoaspartate O-methyltransferase (pcm) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 100% identity to bpy:Bphyt_2355)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T592 at UniProt or InterPro

Protein Sequence (220 amino acids)

>BPHYT_RS11680 protein-L-isoaspartate O-methyltransferase (Burkholderia phytofirmans PsJN)
MHDDLAASRETMVERQLIARGIAEPCILNAMRRVPREAFLSPDLRAWAYADAALPIEAGQ
TITQPFMVARMLQAARLKPEDRVLEIGTGSGYAAAVLAEMVARVDTVERHPQLAESAMDR
LRALGYDNVNVHTADGTLGLPARAPFDAIVATASGPGVPPAWSAQLEIGGRIVMPVGPDP
DHQRLIRLTRDSSTTYHEEMLDLVRFVPLIGAQGWGDMAR