Protein Info for BPHYT_RS11635 in Burkholderia phytofirmans PsJN

Annotation: RNA polymerase subunit sigma-24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 TIGR02957: RNA polymerase sigma-70 factor, TIGR02957 family" amino acids 8 to 286 (279 residues), 373.8 bits, see alignment E=5e-116 PF04542: Sigma70_r2" amino acids 11 to 71 (61 residues), 48.4 bits, see alignment E=6.7e-17 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 11 to 159 (149 residues), 61.4 bits, see alignment E=8.2e-21 PF08281: Sigma70_r4_2" amino acids 107 to 158 (52 residues), 46.8 bits, see alignment 1.9e-16

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to bpy:Bphyt_2345)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T583 at UniProt or InterPro

Protein Sequence (293 amino acids)

>BPHYT_RS11635 RNA polymerase subunit sigma-24 (Burkholderia phytofirmans PsJN)
MDDDVLAFNGLRPRLQKIAYRMLGSVAEAEDIVQDVWLRWHATAREAIDNAEAWLVAVTT
RMSIDRLRAAKIQREHYAGIWLPEPEMTEFPATPEEATERADDVSVAFLVLLERLTPDAR
AAFLLREVFDADYDEVARAIGKTEAACRQLVSRAKAQLRDDRPRSEVPRETHLRLLRTFV
QALQRGDFHAINALLAEDAKLIGDGGGKVQSFPEPMAGGQRIAQLFYASHRRYGDELSVK
LVMLNGQWALLRFIEGELESAQSFETDGERIVRIHVQRNPDKLARIAAAHANG