Protein Info for BPHYT_RS11560 in Burkholderia phytofirmans PsJN
Annotation: Asp/Glu racemase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to HYDRA_PSESN: Hydantoin racemase (hyuE) from Pseudomonas sp. (strain NS671)
KEGG orthology group: K01797, [EC: 5.1.99.-] (inferred from 100% identity to bpy:Bphyt_2330)MetaCyc: 56% identical to allantoin racemase monomer (Klebsiella pneumoniae)
Predicted SEED Role
"Hydantoin racemase (EC 5.1.99.-)" in subsystem Hydantoin metabolism (EC 5.1.99.-)
Isozymes
Compare fitness of predicted isozymes for: 5.1.99.-
Use Curated BLAST to search for 5.1.99.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2T568 at UniProt or InterPro
Protein Sequence (288 amino acids)
>BPHYT_RS11560 Asp/Glu racemase (Burkholderia phytofirmans PsJN) MRIKLINPNTTQRMTEAMGRCAREVAAPGTEVIAVNPTMGPPSIEGYYDEALATPGLLAE VAAGEGEGCDGYVIACFGDPGLYAARELARGPVIGIAEAAMHAASVLAPGFSVVTTLART CGMAWHLAERYGMKRFCRNVRATDVAVLDLDKPGSAARRIILDECRRALAEDGSDAIVLG CAGMAELCAEIEDALGAPVIEGVTAAVKWTEALVALRLSTAKRGDYARPLAKRYDGALAS FSPTDADPNPRAARGATVNSAANAPENAGTADLLRVNTTESGPHIHSV