Protein Info for BPHYT_RS11545 in Burkholderia phytofirmans PsJN

Annotation: allantoicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02961: allantoicase
  • amino acids 17 to 333 (317 residues), 477.1 bits, E=1e-147
• PF03561: Allantoicase
  • amino acids 26 to 172 (147 residues), 180.6 bits, E=8.8e-58
  • amino acids 193 to 335 (143 residues), 159.7 bits, E=2.4e-51

Best Hits

Swiss-Prot: 88% identical to ALLC1_BURMA: Probable allantoicase 1 (alc1) from Burkholderia mallei (strain ATCC 23344)

KEGG orthology group: K01477, allantoicase [EC: 3.5.3.4] (inferred from 100% identity to bpy:Bphyt_2327)

Predicted SEED Role

"Allantoicase (EC 3.5.3.4)" in subsystem Allantoin Utilization (EC 3.5.3.4)

MetaCyc Pathways

• superpathway of purines degradation in plants (14/18 steps found)
• superpathway of allantoin degradation in yeast (5/6 steps found)
• allantoin degradation to glyoxylate I (2/3 steps found)
• allantoin degradation to ureidoglycolate I (urea producing) (1/2 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.4

Use Curated BLAST to search for 3.5.3.4

Sequence Analysis Tools

See B2T565 at UniProt or InterPro

Protein Sequence (337 amino acids)

>BPHYT_RS11545 allantoicase (Burkholderia phytofirmans PsJN)
MALPILDPNAPEFTRRYVNLADPRLGAQALEASDDFFAPKERMLNPEPAVFIPGKYDDNG
KWMDGWETRRKRANGYDWCVVKLARPGVIKGLDLDTSHFTGNFPPAASVEAARVVDGAPN
QSTQWTEIVPSTTLQGNSHHYHEVSDANAYTHLRVNIYPDGGIARLRVYGQPQVDWAGAS
RTEQFDLAAMENGAYLVAANNQHFGAASTILMPGRGVNMGDGWETRRRREPGNDWAIVAL
AQPGVIKKIEVDTAHFKGNFPDRCSIQAAYVTGGTDSSLITQAMFWPVLLGEQKLKMDNQ
HYFESEIAALGPVTHVRFNIIPDGGVSRLRLWGTLAS