Protein Info for BPHYT_RS11500 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 220 to 237 (18 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 281 (270 residues), 103.9 bits, see alignment E=4.3e-34

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_2319)

Predicted SEED Role

"Putative deoxyribose-specific ABC transporter, permease protein" in subsystem Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T557 at UniProt or InterPro

Protein Sequence (309 amino acids)

>BPHYT_RS11500 ABC transporter permease (Burkholderia phytofirmans PsJN)
MDIQQASSLTSSAVTAAIPLMFAGAGELVTEKSGVLNLGVEGMMLMGAVTGYAVTAITGS
PWLGVLAAIGAGLAMSLLFAFLTLTMLANQVATGLSLTIFGIGLSAYVGKPYTSAAVRAT
IDTWTIPGLSKIPVLGPAFFSLTPLDYLAFLMFAVIGWFLYRTRAGLVLRSVGESPQVAH
SVGFPVIGVRYGAVAFGGGMAGLAGGYYSIVNLHLWQEQLTSGRGWIALALVVFATWRPG
RLLIGALLFGAVTGLQFYAQAIGVPVPTQFLAMLPYVATVVVLVLISRNPNTIRLNAPAS
LGKPFFSAG