Protein Info for BPHYT_RS11465 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06945: DUF1289
  • amino acids 11 to 55 (45 residues), 64.8 bits, E=2.5e-22

Best Hits

KEGG orthology group: K06938, (no description) (inferred from 97% identity to bxe:Bxe_A1947)

Predicted SEED Role

"Phosphoenolpyruvate synthase (EC 2.7.9.2)" in subsystem Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.9.2)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 2.7.9.2

Use Curated BLAST to search for 2.7.9.2

Sequence Analysis Tools

See B2T550 at UniProt or InterPro

Protein Sequence (67 amino acids)

>BPHYT_RS11465 hypothetical protein (Burkholderia phytofirmans PsJN)
MASNLHDLPDSPCIGVCSTLFDDVCKGCGRTAVEVSNWVFLSDEEKRAVWVRIEQEGTAM
RFANDKL