Protein Info for BPHYT_RS11455 in Burkholderia phytofirmans PsJN

Annotation: manganese transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 300 to 324 (25 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 28 to 398 (371 residues), 336.8 bits, see alignment E=1.1e-104 PF01566: Nramp" amino acids 47 to 403 (357 residues), 402.9 bits, see alignment E=6e-125

Best Hits

Swiss-Prot: 50% identical to MNTH_XANCP: Divalent metal cation transporter MntH (mntH) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03322, manganese transport protein (inferred from 100% identity to bpy:Bphyt_2310)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T548 at UniProt or InterPro

Protein Sequence (433 amino acids)

>BPHYT_RS11455 manganese transporter (Burkholderia phytofirmans PsJN)
MNTNPFALRPNRRRRLPADGGARPPHWFSFVGAGALIAVGYIDPGNWATALGAGAGYGYR
LLGMVLLSSLMAMLLQWLSSRLGVVTGRDLAQVCRERTGRRGTLFLWLTSEVAIIACDVA
EVVGSAVALQMLLGVSLTVGVLMSAVCTFALLALQQKGRKLEAVIAVLIGFVGLCFVVQL
ALARPDWHAALAGTVPSVELLRNAGMVWLAAGIVGATVMPHNLYLHSALVKHHAPDGSDA
QIKVALHVVNLDTFGSLSFAFVINAALLIVAAAVFYVSGHRDVTDLADAHRLIAPLVGTH
WAGILFAAALLACGLSATVTGTLAGQAVMEGFLRIRLPRWKRALLTRALAIGPALFAVAL
FGQHGSNQLLVASQVVLSLQLPLAVVPLIRFTSDATLMRGWRVRGVPLVLAWLSAAFIIM
LNGALLWQLAFGS