Protein Info for BPHYT_RS11420 in Burkholderia phytofirmans PsJN

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF12146: Hydrolase_4" amino acids 63 to 298 (236 residues), 54.4 bits, see alignment E=2.3e-18 PF00561: Abhydrolase_1" amino acids 63 to 300 (238 residues), 88.6 bits, see alignment E=1.1e-28 PF12697: Abhydrolase_6" amino acids 64 to 304 (241 residues), 75.4 bits, see alignment E=2.1e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2302)

Predicted SEED Role

"3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T540 at UniProt or InterPro

Protein Sequence (329 amino acids)

>BPHYT_RS11420 alpha/beta hydrolase (Burkholderia phytofirmans PsJN)
MASIDSGTPASTSSLPPRSLAARLGITSVPRDELRRRYTQSGSSFVKIMGADVHYVDEGS
GDIIVMIHGFASSLHTWNRVADELKREHRVIRLDLPPFGVTGPLRSSSGAIETMNLPTYR
RFIDTFMQALGISRATFMGNSLGGLIAWDYAVRHRDAVERLVLIDSAGFPMKLPIYIGLF
NSALVRVSSPWWLPEVIVKSAVRNVYGDPRKIDAVTLRRYVEFFHGEGTRTAIGKMVPTL
DFEDVDTDVLKTLDVPTLVLWGAKDRWIPTAHAAEFASRIPGAKSVMYPGLGHIPMEEAP
ERVMADLRAFLGTRGARVPVDEGTRRAPA