Protein Info for BPHYT_RS11325 in Burkholderia phytofirmans PsJN

Annotation: voltage-gated chloride channel protein ClcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 163 to 189 (27 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 370 to 394 (25 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 80 to 420 (341 residues), 311.4 bits, see alignment E=8.4e-97 PF00571: CBS" amino acids 451 to 502 (52 residues), 21 bits, see alignment 3.4e-08

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to bpy:Bphyt_2283)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T517 at UniProt or InterPro

Protein Sequence (577 amino acids)

>BPHYT_RS11325 voltage-gated chloride channel protein ClcB (Burkholderia phytofirmans PsJN)
MLSFLLKLRTRAQNLFRLSDAHTMLIWSVVVGVAGAFATIAFREAIALLQFAIVGKSGSF
VEMARGLPWTVRIWLPAAGGLIAGFLLLIARRYEDKCNHIDYMEAVAIGDGVVPVKLSMW
RSVSSLFTISSGGSIGREGPMVQLAALAGSLIGRWVHFDPPRLRLLVACGAAAGITSAYS
APIAGAFFVTEIVLGSIAMESFGPVVVSAVVANITMREFAGYKPPYEMPVFPPVAGLEVL
LFVALGALCGAAAPQFLRLLDLSKQSFRKLPVPLPVRLALGGLVVGILSVWTPEVWGNGY
SVVNAILHSPWTWTALVLVLVFKIVATAATAGSGAVGGVFTPTLFVGAVVGSLFGQGMHA
LWPHGTSAPFAYAMVGMGAFLAGATQAPLMAILMIFEMTLSYQVVLPLMLSCVVAYFVSR
AIGKNSMYEITLRRNHEEQERSRLRATQMRELIRPAETVVPPNATVHDMTRVFLEYPVKY
LYVANESGAFLGVVALKDITSDLLDGSDTSAKTAANYLQPHFDVLTPDMPLGVALQHFLA
FQGERLPVVESAAHPTLAGVVYKTSLLDAYFRMNPTR