Protein Info for BPHYT_RS11280 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details PF10086: YhfC" amino acids 18 to 250 (233 residues), 276.2 bits, see alignment E=9.5e-87

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2274)

Predicted SEED Role

"Membrane protein DUF2324 in 2-Ketogluconate Utilization cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T512 at UniProt or InterPro

Protein Sequence (272 amino acids)

>BPHYT_RS11280 membrane protein (Burkholderia phytofirmans PsJN)
MVVAPLTLSSLALATLLVAALPFLIYRRLRRPLALKPRDAITGIAVFALFAMVIERALND
YVLHRNEATANFLSNPLAFVVYGALAAGICEEVGRFIGMRLLLRRAAAKAGSTSLAAGTN
DGTALTYGLGHGGAEAWLVGVLVQIQWILFAVFENRGQLDGYLSNLPTDSLMRIHLILAS
LTPQTAGIFALERVAALVFQIGLSVLMWRGLRAGWRGILPLAIGLHALVDVPAAMFQAQL
VPLAAVDALYAVGAVIVAGLLFRAYRRPVVAA