Protein Info for BPHYT_RS11210 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 46 to 70 (25 residues), see Phobius details amino acids 85 to 124 (40 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 277 to 294 (18 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 328 to 344 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 76 to 339 (264 residues), 175.1 bits, see alignment E=8.1e-56

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to bpy:Bphyt_2261)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4Z9 at UniProt or InterPro

Protein Sequence (351 amino acids)

>BPHYT_RS11210 ABC transporter permease (Burkholderia phytofirmans PsJN)
MNDQPLREASGDKPGTAGGTGSVTPPADPSAPLASGKPAGTRLGFSNYLGLAGALLGMIV
LFSLLSSHFLTYDTFSTIANQIPDLVVMSVGMTFVLIIAGIDLSVGSVLALGASVVSVAA
LKWGWGPLPSAVLGVAAAALTGTITGAVTVGWRIPSFIVSLGVLEAARGMAYQMTNSRTA
YIGDAFDFLSNPIALGISPAFLIAVAVMVIAQLVLTRTVFGRYLVGIGTNEEAVRLAGVN
PRPYKVIVFALMGALSGLAALFQISRLEAADPNAGQGVELQVIAAVVIGGTSLMGGRGSV
ISTFFGVLIISVLAAGLAQIGANEPTKRMITGAVIVVAVVLDTYRSRRKRA