Protein Info for BPHYT_RS11175 in Burkholderia phytofirmans PsJN

Annotation: alpha-ketoglutarate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 334 to 357 (24 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details amino acids 403 to 421 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 23 to 219 (197 residues), 88.6 bits, see alignment E=4.5e-29 amino acids 220 to 417 (198 residues), 38.7 bits, see alignment E=6.1e-14 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 28 to 415 (388 residues), 459.7 bits, see alignment E=4.6e-142 PF07690: MFS_1" amino acids 66 to 381 (316 residues), 96.1 bits, see alignment E=2.1e-31 amino acids 268 to 427 (160 residues), 49.1 bits, see alignment E=4e-17

Best Hits

Swiss-Prot: 73% identical to KGTP_SHIFL: Alpha-ketoglutarate permease (kgtP) from Shigella flexneri

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 100% identity to bpy:Bphyt_2254)

MetaCyc: 73% identical to alpha-ketoglutarate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-23

Predicted SEED Role

"dicarboxylic acid transporter PcaT" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4Z2 at UniProt or InterPro

Protein Sequence (434 amino acids)

>BPHYT_RS11175 alpha-ketoglutarate transporter (Burkholderia phytofirmans PsJN)
MTDLTDQTVASAHDTRRRIFAIVGASSGNLVEWFDFYVYSFCALYFAPAFFPSGNTTTQL
LNTAGVFAAGFLMRPIGGWFFGRLADKHGRRTAMMVSVFMMCGGSLVIAVLPTYAQIGAL
APALLLVARLFQGLSVGGEYGTSATYMSEVALKGRRGFFASFQYVTLIGGQLCALLVLVV
LQQTLSNDELKAWGWRVPFAIGAVAALVALYLRKSLDETTTAETRQRKEAGTLRGLWLHK
GAFMTVLGFTAGGSLIFYTFTTYMQKYLVNTAGMHAKTASNVMTAALFVYMVMQPAFGAL
SDRIGRRRSMLFFGFFATIGTVPLLHALKDVTSPYAAFGLVVVALAIVSFYTSISGLIKA
EMFPPEVRALGVGLSYAVANAIFGGSAEYVALWLKSVGNESIFYWYVTALCAIAGIVSLR
MRDPSKEGYLRLEP