Protein Info for BPHYT_RS11120 in Burkholderia phytofirmans PsJN

Annotation: ferredoxin--NADP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF07992: Pyr_redox_2" amino acids 15 to 300 (286 residues), 77.1 bits, see alignment E=4e-25 PF13738: Pyr_redox_3" amino acids 17 to 294 (278 residues), 64.5 bits, see alignment E=2.6e-21 PF00070: Pyr_redox" amino acids 164 to 221 (58 residues), 30.2 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 100% identical to FENR_PARPJ: Ferredoxin--NADP reductase (Bphyt_2243) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 100% identity to bpy:Bphyt_2243)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4Y1 at UniProt or InterPro

Protein Sequence (349 amino acids)

>BPHYT_RS11120 ferredoxin--NADP reductase (Burkholderia phytofirmans PsJN)
MTSAADQQPPPIRTDVLIVGAGPVGLFAAFEAGVIGLSCQIVDGLDKVGGQCIELYPDKP
IYDIPAIASCTARELVERLLAQCKPFDPPIHLEQRVESVEQNDDGRWTVRTDRGLVFDVA
AILLAAGNGAFVPQKLALAEAVPLESRHVHYSVPRLADFADKVVVVAGGGDSALDWALAL
RKVARRVTLVHRRSGFSAADSSVASMRRAVEAGEMDFIVGAIAGLNVEGDALKSITLRHI
EGETQLAAEHLVALYGLVADLGPIAQWGLSIHAGRVDVDTSNYESSRPGIFAVGDIANYP
NKQKLILSGFHEASLALRRAYSYAYPDKKRVHVHSSYDAKLAEKVSATG