Protein Info for BPHYT_RS11020 in Burkholderia phytofirmans PsJN

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 97 to 112 (16 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details PF07331: TctB" amino acids 10 to 166 (157 residues), 76.7 bits, see alignment E=1.1e-25

Best Hits

KEGG orthology group: K07794, putative tricarboxylic transport membrane protein (inferred from 100% identity to bpy:Bphyt_2222)

Predicted SEED Role

"Tricarboxylate transport protein TctB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4W0 at UniProt or InterPro

Protein Sequence (172 amino acids)

>BPHYT_RS11020 transporter (Burkholderia phytofirmans PsJN)
MKSIRSDVWLAFCAMALAVVYLYMDMRLPEVRLSDPLGPKAFPALVGVGLIASAVVLLLE
GRGKAHAKAVEAPPAQTAADAEPALVNHAVPEPKQRPFILISMVVWTAIYYLCFEPVGYV
LSTSVFLFGLLSYFNRQRHKTNLAIALGVTVVFDLLFSQLLGVPVPTGLLPF