Protein Info for BPHYT_RS10980 in Burkholderia phytofirmans PsJN

Annotation: 2-dehydro-3-deoxy-6-phosphogalactonate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 PF02746: MR_MLE_N" amino acids 17 to 114 (98 residues), 76.8 bits, see alignment E=1.6e-25 PF13378: MR_MLE_C" amino acids 137 to 388 (252 residues), 135 bits, see alignment E=3.2e-43

Best Hits

Swiss-Prot: 53% identical to IMND2_ENTGE: D-galactonate dehydratase family member EGBG_02030 (EGBG_02030) from Enterococcus gallinarum (strain EG2)

KEGG orthology group: K08323, starvation sensing protein RspA (inferred from 100% identity to bpy:Bphyt_2214)

Predicted SEED Role

"Starvation sensing protein RspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4V3 at UniProt or InterPro

Protein Sequence (415 amino acids)

>BPHYT_RS10980 2-dehydro-3-deoxy-6-phosphogalactonate aldolase (Burkholderia phytofirmans PsJN)
MATLITDVKVILTAPEGINLIVVKVETNQPGLYGLGCSTFAYRHVAVQCLIEEYLRPLLI
GRDADAIEELWQLMHQNAYWRNGPIENNAISGVDMALWDIKGKLANMPLYQLFGGKCREG
VPIYRHADGRDLNELCENIQKYREQGITHIRCQSGGYGGGGFGKAPASAPHGSADGVYLD
SRKYMRDTLKLFDGIRSKIGFDVALCHDVHERLKPVEAIRFACELERYELFFLEDAIALE
EGEWMRQLRAKTTTPLAQGELFNNPYEWRFLITERLIDFIRVHLSQIGGITAARKLQIFA
EQFGVRTAWHGPGDMSPLAHAANIHIDLAARNFGVQEWSGTEPPNFVIQDLKGPRAALLD
VFPGLPEFRQGYVYANDKPGLGVDIDEAEAAKYPCENSVTTWTQTRLKDGTLQTP