Protein Info for BPHYT_RS10950 in Burkholderia phytofirmans PsJN

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF09339: HTH_IclR" amino acids 33 to 82 (50 residues), 51.4 bits, see alignment 1.8e-17 PF13412: HTH_24" amino acids 38 to 80 (43 residues), 30.6 bits, see alignment 5.1e-11 PF12802: MarR_2" amino acids 38 to 83 (46 residues), 37.7 bits, see alignment 4.6e-13 PF08279: HTH_11" amino acids 46 to 78 (33 residues), 29.4 bits, see alignment 1.5e-10 PF01614: IclR" amino acids 148 to 272 (125 residues), 132.7 bits, see alignment E=1.9e-42

Best Hits

Swiss-Prot: 60% identical to KDGR_ECOLI: Transcriptional regulator KdgR (kdgR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2208)

Predicted SEED Role

"Transcriptional regulator KdgR, KDG operon repressor" in subsystem D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4U7 at UniProt or InterPro

Protein Sequence (290 amino acids)

>BPHYT_RS10950 transcriptional regulator (Burkholderia phytofirmans PsJN)
MASTGKRRKDDGAAQAQDAENADCGERGESASSIGRVFAILGAIGDSGQIGISELSQRLG
MSKTTVHRVIQTLKALGYVTQEVETERYRLTIRLFELGAKALESVDLVREADVEMRRIGE
ATREAVHLGAFDEDAIIYIHKIDADYGLRMQSRIGRRNPLHSTAIGKVLLAWMDPADARE
VLSHVEFRKSTQKTLSSAEAVLNILPHVREQGYGEDNEEQEEGLRCLAVPVFDRFGRVIA
GLSISFPTMRCGADTKSHYVALLRKSGLAISTRLGYRETTAPEQIAAEPG