Protein Info for BPHYT_RS10885 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details TIGR03472: hopanoid biosynthesis associated glycosyl transferase protein HpnI" amino acids 10 to 406 (397 residues), 455.2 bits, see alignment E=7.4e-141 PF00535: Glycos_transf_2" amino acids 69 to 235 (167 residues), 30.1 bits, see alignment E=9.1e-11 PF13641: Glyco_tranf_2_3" amino acids 78 to 296 (219 residues), 102.6 bits, see alignment E=6.4e-33 PF13506: Glyco_transf_21" amino acids 124 to 294 (171 residues), 151.3 bits, see alignment E=4e-48 PF13632: Glyco_trans_2_3" amino acids 155 to 341 (187 residues), 71 bits, see alignment E=2.7e-23

Best Hits

KEGG orthology group: K00720, ceramide glucosyltransferase [EC: 2.4.1.80] (inferred from 100% identity to bpy:Bphyt_2195)

Predicted SEED Role

"Ceramide glucosyltransferase (EC 2.4.1.80)" (EC 2.4.1.80)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.80

Use Curated BLAST to search for 2.4.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4T4 at UniProt or InterPro

Protein Sequence (435 amino acids)

>BPHYT_RS10885 glycosyl transferase (Burkholderia phytofirmans PsJN)
MAAHAVTACQWVLLAVCSSASLYALLAAVAMPFFGSRRGAASGASYSTSHVSQRQPQPQP
HRFARVGVSVLKPLCGAEPRLYDNLRTFCDQRHEHFQLVLGVSSPDDAAIAVVRRLQAAY
PLHDIELAIDTRVHGSNLKVSNLINMAARARHDVIVIADSDIAVEADYLDSVAAPLADPR
VGVVTCLYVARGIGGFWPRVGALFINEWFAPSVRVAHAAGSRRFGFGATLALRRATLERI
GGFEALKNCLADDYWLAEHVRALGLQTVLSRVMVATDVIEPTFGALWQRETRWLRTIRSV
NAPGFAFLFITFPTPWLVAGAWLGASLAATSSDAVHAWAAFTSATGAAAGLTARLLMHLR
SARRERTFWRDLPLVPLRDTLLALQWCAAVFGSHVTWRGARVPVQVSRVSRASTSTAARD
GALNVMDVMEASDGG