Protein Info for BPHYT_RS10845 in Burkholderia phytofirmans PsJN

Annotation: UbiD family decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 TIGR00148: decarboxylase, UbiD family" amino acids 25 to 452 (428 residues), 355.6 bits, see alignment E=1.7e-110 PF20695: UbiD_N" amino acids 29 to 105 (77 residues), 48.2 bits, see alignment E=1.4e-16 PF01977: UbiD" amino acids 114 to 312 (199 residues), 227.2 bits, see alignment E=1.8e-71 PF20696: UbiD_C" amino acids 318 to 450 (133 residues), 126.9 bits, see alignment E=7e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2187)

MetaCyc: 76% identical to 2,5-furan-dicarboxylic acid decarboxylase 1 (Cupriavidus basilensis)
RXN-13093

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4S1 at UniProt or InterPro

Protein Sequence (494 amino acids)

>BPHYT_RS10845 UbiD family decarboxylase (Burkholderia phytofirmans PsJN)
MNTRDAVSHGNFQLTWGRPSGVLTLRDWLAHLARTDRVATIDKPVELEHELAAIAKRLDG
TQAAFFTKPGGHDVPVVSGFMSRRAWIAEAMGVAEADLLTRFRDAADQPLPSKEISRAEA
ACQQVVHTGGIDLHKLLPIPTHSEHDNGPYITAGLVIARNPRTGVQNVSINRIQVHGPDR
MAILLLPRHLYAFQKAAEEAGDALDVAIAIGVDPLTMLASQAISPIDSDELEIAGALHGA
PLPVVKCVSNGVNVPAFAEIVIEGRILPNVRELEGPFGEFPKYYSAQEAREVIEVTAVTH
REKPIFHTIVPAEMEHLLLGAIPREATLLAHLQRSHPNVKDVHLSVGGVCRYHLWVQFEK
KREGEAKNVILCAFGAHYDIKQVVVVDTDVDVHDPAEIEWAIATRFQADRDLVVIEGAQG
SPLDPSTTVGQPEDAPPHLQGVSAKMGLDATRPVVYPSHVFTRVRIPGQDMVNLDELVAA
DNTAFDTYLGGAHG