Protein Info for BPHYT_RS10840 in Burkholderia phytofirmans PsJN

Annotation: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases" amino acids 10 to 192 (183 residues), 237 bits, see alignment E=5.9e-75 PF02441: Flavoprotein" amino acids 10 to 180 (171 residues), 144.8 bits, see alignment E=9.4e-47

Best Hits

Swiss-Prot: 57% identical to UBIX_NEIMB: Flavin prenyltransferase UbiX (ubiX) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 100% identity to bpy:Bphyt_2186)

MetaCyc: 78% identical to 2,5-furan-dicarboxylic acid decarboxylase 2 (Cupriavidus basilensis)
RXN-13093

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4S7 at UniProt or InterPro

Protein Sequence (208 amino acids)

>BPHYT_RS10840 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (Burkholderia phytofirmans PsJN)
MAEHAHKPQRIVVGISGASGAVIGVRLLAALRRLGTQETHLIVSASGAVTAAQELGMTRG
DLDSLADVVYNVRDIGAAVASGSFITAGMVIAPCSMKTLAGVANGFADNLLTRAADVMLK
ERRRLVLVARETPLNLAHLRNMTSVTEMGGIVMPPVPAFYAHPKTIEDVVDHTVGRILDL
FAIEHREIAQRWSGLADEFTERRSGVDE