Protein Info for BPHYT_RS10805 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 356 to 379 (24 residues), see Phobius details amino acids 391 to 414 (24 residues), see Phobius details amino acids 420 to 442 (23 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 405 (373 residues), 74.9 bits, see alignment E=6e-25 PF00083: Sugar_tr" amino acids 63 to 448 (386 residues), 77.6 bits, see alignment E=9.8e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2179)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4R8 at UniProt or InterPro

Protein Sequence (458 amino acids)

>BPHYT_RS10805 MFS transporter (Burkholderia phytofirmans PsJN)
MSVAAQNGAALPAVDQRQVMGAVMASCLGWALDLFDLFVLLFVAPVVGRLFFPSEHAMLS
LAAVYASFAVTLLMRPLGSAWFGSYADRHGRKGAMIIAVVGVGLSTAAFGLLPTVAQVGL
VAPILFLVLRLVQGVFVGGVVASTHTIGTESVAPKYRGAVSGLIGGGGAGLGALLASLTY
LAMSALFPGAAFDVWGWRCMFFTGIISSVLGLFVFSSLEESPLWKKLAAEKAAKAAAQKL
DTPVEIVRSPLRTLFSRDYRSILLVNLLLTIGGGSGYYLTSGYLPTFLKVVSHAPNGAAA
AILLICSVAVVIASVAAGHLSTFIGRKSAFIWLGLIRLFALPALFLLLPTAQSITMIGVY
AVILSALGSAGYAPILIFLNERFPTAIRATGTGLSWNIGFAIGGMMPTAVSLVAKDASEL
PMTLAIFVGAISVIFLIGAFVVPETRGRLEQGAVREPA