Protein Info for BPHYT_RS10705 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 128 to 155 (28 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 29 to 246 (218 residues), 79 bits, see alignment E=3.5e-26 amino acids 278 to 390 (113 residues), 28.7 bits, see alignment E=6.7e-11 PF07690: MFS_1" amino acids 61 to 381 (321 residues), 95.2 bits, see alignment E=4e-31 amino acids 267 to 433 (167 residues), 40.5 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_2159)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T4P9 at UniProt or InterPro

Protein Sequence (438 amino acids)

>BPHYT_RS10705 MFS transporter (Burkholderia phytofirmans PsJN)
MQNDTFSPTAGSPPVSAAPTTSRTLRRIIIASVLGNALEWYDFFLYGTAAALIFGPLFFP
LHGDPLLGTLAAFAGFAIGFLARPLGGIVFGHIGDRHGRKRALVITLMMMGVATFGIGLL
PTFSQVGFLAPAALVCLRVVQGIASGGEWGGGVLLISESAPANRRGYYAAFSQLGVAGGF
VLSAAAFYLVQRLPVESFMSWGWRVPFLASVLIFGVGVYIRRRLPESRDFTAAKPKHMPV
LTVLRNHPKQVLQAMGLRVAENGGTYIFLSFVLVYGKTIGVPVSVMLGGVMVAMLLELVT
IVLWGRLSDVIGRRPVYMIGALGLVVIAFPAFWLIDTHQPMLVFLSLVLGLPFCHAAMIG
TQPALMGELFPTEVRYSGMALGHEIASVFSGGLAPLVATALYAQVRAPWPVALMLIGFGV
ITALTLVTIPRNTSTTHD