Protein Info for BPHYT_RS10665 in Burkholderia phytofirmans PsJN
Annotation: muconolactone delta-isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 95% identical to CATC2_ACILW: Muconolactone Delta-isomerase 2 (catC2) from Acinetobacter lwoffii
KEGG orthology group: K03464, muconolactone D-isomerase [EC: 5.3.3.4] (inferred from 100% identity to bpy:Bphyt_2151)MetaCyc: 71% identical to muconolactone isomerase (Pseudomonas reinekei)
Muconolactone Delta-isomerase. [EC: 5.3.3.4]
Predicted SEED Role
"Muconolactone isomerase (EC 5.3.3.4)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 5.3.3.4)
MetaCyc Pathways
- aromatic compounds degradation via β-ketoadipate (9/9 steps found)
- superpathway of salicylate degradation (7/7 steps found)
- catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
- catechol degradation to β-ketoadipate (4/4 steps found)
- mandelate degradation to acetyl-CoA (12/18 steps found)
- 4-methylcatechol degradation (ortho cleavage) (4/7 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 5.3.3.4
Use Curated BLAST to search for 5.3.3.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2T4P1 at UniProt or InterPro
Protein Sequence (96 amino acids)
>BPHYT_RS10665 muconolactone delta-isomerase (Burkholderia phytofirmans PsJN) MLFHVEMTVHLPADMDAERAARLKADEKAMSQRLQQEGVWRHLWRIAGRYANISVFDVES PAHLHDVLSQLPLFPYMDVEVRALCRHASSIRDDDR